Novel hGHRH homodimer promotes fertility of female infertile hamster by up-regulating ovarian GHRH receptor without triggering GH secretion
Author:Juan-Hui Zhang, Xu-Dong Zhang, Lin-Na Yue, Xiao-Yuan Guo, Jing-Xuan Tang, Li-Rong Guo, Yun Li, Song-Shan Tang 《European Journal of Pharmaceutical Sciences》
ABSTRACTS
Extra-hypothalamic growth hormone-releasing hormone (GHRH) plays an important role in infertility. The female infertility models were formed by intraperitoneally injecting cyclophosphamide in 5-week-old Chinese hamster once in a week for 5?weeks. All the models mated with healthy male hamster in the ratio of 1:1 in the experimental 6–8th week and the couples were separated to breed in the 9–10th week. 20?mg/kg of cyclophosphamide induced temporary interference of reproduction and did not cause significant difference in the weight of body, bilateral ovaries, or liver. By intramuscularly injecting twice in a week during the experimental 4–10th week, 2, 4, 8?mg/kg of Grin induced 30, 42.9, 60% of total pregnancy rates in a dose-dependent manner whereas 200?U/kg of hMG induced 50% of total pregnancy rates. The single cyclophosphamide dose caused strongly eosinophilic ovarian cells, scattered early follicles, many atretic follicles, and no corpora luteum was observed. The hMG group individually presents many follicles at all levels, especially secondary ones in the ovarian cortex and medulla. Much of loose connective tissue, vacuoles, and sparse interstitial cells distribute in the medulla. Grin induced many follicles at all dose levels and corpora lutea in the cortex, and the compactly aligned interstitial cells occurred in the whole ovarian tissue.
Graphical abstract
KEY WORDS
Female infertility; Chinese hamster infertility model; Ovary; Human growth hormone-releasing hormone analog dimer; Growth hormone releasing-hormone receptor
SCREENSHOT
RELATED PRODUCTS
Grin monomer [(H)PADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARLGGC(OH)] and hGHRH(1-44)NH 2 [(H)YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL( NH 2 )] were manufactured by solid phase synthesis (China Peptides Co., Ltd., China)
CHAINING
https://www.sciencedirect.com/science/article/pii/S0928098718301271
Grin monomer|PADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARLGGC
hGHRH(1-44)NH2|YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Коментарі